PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004511964.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 307aa    MW: 34099 Da    PI: 6.8267
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004511964.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-4281071100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk lrrkC+++Cv+apyfp ++p++f +vhk+FGasnv+kll++l+ ++r+da++sl+yeAear rdPvyG+vg+i+ lq++l+q + el+
  XP_004511964.1   8 PCAACKSLRRKCTRECVFAPYFPPDNPQRFTYVHKVFGASNVTKLLNELDATQRDDAVKSLAYEAEARFRDPVYGCVGLISLLQHKLRQIQGELN 102
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +k+e
  XP_004511964.1 103 NAKKE 107
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6537108IPR004883Lateral organ boundaries, LOB
PfamPF031954.9E-428105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTSSSNSPCA ACKSLRRKCT RECVFAPYFP PDNPQRFTYV HKVFGASNVT KLLNELDATQ  60
RDDAVKSLAY EAEARFRDPV YGCVGLISLL QHKLRQIQGE LNNAKKELAT YIGPQALQGV  120
PTTILQQQHP NNHFGNSLYP YNNGNVLTTV TAATQMVISD LQPPPSQHPI LEAQQLAAAV  180
VAREQQEMFR SFEHQQQQQE FLRFSGGLDV DSVSSGGDFN HVSPVVVAST DQLSPSLALG  240
SFDNTYHHMQ QPQQGHGEPH HQHLTLQAQL LLPPQQKQVQ TQTQHSSLTH HQQQTESEEC  300
RSVGPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004511963.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_004511964.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-66LBD36_ARATH; LOB domain-containing protein 36
TrEMBLV7CHR21e-140V7CHR2_PHAVU; Uncharacterized protein
STRINGGLYMA11G06210.21e-136(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-63ASYMMETRIC LEAVES 2-like 1